PDB entry 2m00

View 2m00 on RCSB PDB site
Description: Solution structure of staphylococcal nuclease E43S mutant in the presence of ssDNA and Cd2+
Class: hydrolase
Keywords: hydrolase
Deposited on 2012-10-14, released 2013-03-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-04-03, with a file datestamp of 2013-03-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:196620]
    Gene: nuc, MW0769
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NXI6 (0-148)
      • engineered mutation (42)
    Domains in SCOPe 2.05: d2m00a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m00A (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpstkhpkkgvekygpeasa
    ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
    heqllrkseaqakkeklniwsednadsgq