PDB entry 2lzz

View 2lzz on RCSB PDB site
Description: Solution structure of a mutant of the triheme cytochrome PpcA from Geobacter sulfurreducens sheds light on the role of the conserved aromatic residue F15
Class: electron transport
Keywords: Geobacter, Triheme cytochrome, Site-directed mutagenesis, Electron transport
Deposited on 2012-10-12, released 2013-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-03-13, with a file datestamp of 2013-03-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytochrome c, 3 heme-binding sites
  Species: Geobacter sulfurreducens [TaxId:663917]
  Gene: GSU0612, KN400_0591, ppcA
  Database cross-references and differences (RAF-indexed):
  • Uniprot D7AFU0 (0-70)
    • engineered mutation (14)
  Domains in SCOPe 2.08: d2lzza_
• Heterogens: HEM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2lzzA (A:)
  addivlkakngdvklphkahqkavpdckkchekgpgkiegfgkemahgkgckgcheemkk
  gptkcgechkk