PDB entry 2lzg

View 2lzg on RCSB PDB site
Description: NMR Structure of Mdm2 (6-125) with Pip-1
Class: protein binding
Keywords: Mdm2, oncogene protein-inhibitor complex, PROTEIN BINDING
Deposited on 2012-10-02, released 2012-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-07, with a file datestamp of 2012-11-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2lzga_
  • Heterogens: 13Q

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lzgA (A:)
    mcntnmsvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqy
    imtkrlydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgt
    svsen