PDB entry 2lz2

View 2lz2 on RCSB PDB site
Description: the three dimensional structure of turkey egg white lysozyme at 2.2 angstroms resolution
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1988-10-20, released 1989-10-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.192
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: turkey egg white lysozyme
    Species: Meleagris gallopavo [TaxId:9103]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2lz2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lz2A (A:)
    kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
    rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
    hawirgcrl