PDB entry 2lz2

View 2lz2 on RCSB PDB site
Description: the three dimensional structure of turkey egg white lysozyme at 2.2 angstroms resolution
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1988-10-20, released 1989-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: turkey egg white lysozyme
  Species: Meleagris gallopavo [TaxId:9103]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00703 (0-128)
  Domains in SCOPe 2.08: d2lz2a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2lz2A (A:)
  kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
  rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
  hawirgcrl