PDB entry 2lyp

View 2lyp on RCSB PDB site
Description: NOE-based 3D structure of the monomer of CylR2 in equilibrium with predissociated homodimer at 266K (-7 Celsius degrees)
Class: DNA binding protein
Keywords: homodimer, CylR2, DNA binding protein, NOE-based structure, protein folding, cold denaturation, cytolysin repressor 2, helix-turn-helix, ensemble calculations, fast exchange dimer-monomer equlibrium, dimer dissociation
Deposited on 2012-09-19, released 2013-02-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-04-03, with a file datestamp of 2013-03-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cylr2
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: cylR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2lypa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2lypA (A:)
miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylntpledi
fqwqpe