PDB entry 2lyj

View 2lyj on RCSB PDB site
Description: NOE-based 3D structure of the CylR2 homodimer at 298K
Class: DNA binding protein
Keywords: homodimer, CylR2, DNA binding protein, NOE-based structure, protein folding, cold denaturation, cytolysin repressor 2, helix-turn-helix
Deposited on 2012-09-19, released 2013-02-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-04-03, with a file datestamp of 2013-03-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cylr2
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: cylR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2lyja_
  • Chain 'B':
    Compound: cylr2
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: cylR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2lyjb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lyjA (A:)
    miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylntpledi
    fqwqpe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lyjB (B:)
    miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylntpledi
    fqwqpe