PDB entry 2lya

View 2lya on RCSB PDB site
Description: Structure of HIV-1 myr(-) matrix protein in complex with 1,2-dioctanoyl-sn-phosphatidylcholine
Class: viral protein
Keywords: Gag, matrix, plasma membrane, lipid, VIRAL PROTEIN
Deposited on 2012-09-14, released 2013-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-03, with a file datestamp of 2013-03-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Matrix protein p17
    Species: Human immunodeficiency virus type 1 [TaxId:11698]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2lyaa_
  • Heterogens: PC8

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2lyaA (A:)
    garasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqil
    gqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad
    tgnnsqvsqnyhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lyaA (A:)
    garasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqil
    gqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad
    tgnnsqvsqny