PDB entry 2ly6

View 2ly6 on RCSB PDB site
Description: Refined solution structure of recombinant brazzein at low temperature
Class: plant protein
Keywords: CYS-SAIL, brazzein, PLANT PROTEIN
Deposited on 2012-09-12, released 2012-10-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Defensin-like protein
    Species: Pentadiplandra brazzeana [TaxId:43545]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ly6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ly6A (A:)
    dkckkvyenypvskcqlanqcnydckldkharsgecfydekrnlqcicdycey