PDB entry 2ly5

View 2ly5 on RCSB PDB site
Description: Refined solution structure of recombinant brazzein
Class: plant protein
Keywords: CYS-SAIL, RDC, brazzein, PLANT PROTEIN
Deposited on 2012-09-12, released 2013-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Defensin-like protein
    Species: Pentadiplandra brazzeana [TaxId:43545]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ly5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ly5A (A:)
    dkckkvyenypvskcqlanqcnydckldkharsgecfydekrnlqcicdycey