PDB entry 2lxp

View 2lxp on RCSB PDB site
Description: NMR structure of two domains in ubiquitin ligase gp78, RING and G2BR, bound to its conjugating enzyme Ube2g
Class: ligase
Keywords: RING domain, ubiquitin, ligase
Deposited on 2012-08-30, released 2013-08-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-02, with a file datestamp of 2013-09-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 G2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2G2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2lxpa_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase AMFR
    Species: Homo sapiens [TaxId:9606]
    Gene: AMFR, RNF45
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: E3 ubiquitin-protein ligase AMFR
    Species: Homo sapiens [TaxId:9606]
    Gene: AMFR, RNF45
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2lxpc_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2lxpA (A:)
agtalkrlmaeykqltlnppegivagpmneenffewealimgpedtcfefgvfpailsfp
ldyplsppkmrftcemfhpniypdgrvcisilhapgddpmgyessaerwspvqsvekill
svvsmlaepndesganvdaskmwrddreqfykiakqivqkslgl

    Sequence, based on observed residues (ATOM records): (download) 
    >2lxpA (A:)
agtalkrlmaeykqltlnppegivagpmneenffewealimgpedtcfefgvfpailsfp
ldyplsppkmrftcemfhpniypdgrvcisilhapgsaerwspvqsvekillsvvsmlae
pndesganvdaskmwrddreqfykiakqivqkslgl

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2lxpC (C:)
avatpeelavnnddcaicwdsmqaarklpcghlfhnsclrswleqdtscptcrmslni