PDB entry 2lxk

View 2lxk on RCSB PDB site
Description: Backbone 1H, 13C, and 15N Chemical Shift Assignments for cold shock protein, LmCsp
Class: transcription
Keywords: Protein, Nucleic Acids, TRANSCRIPTION
Deposited on 2012-08-27, released 2013-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cold shock-like protein CspLA
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: cspLA, cspA, cspL, lmo1364
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2lxka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2lxkA (A:)
meqgtvkwfnaekgfgfierengddvfvhfsaiqgdgfksldegqavtfdveegqrgpqa
anvqka