PDB entry 2lxh

View 2lxh on RCSB PDB site
Description: NMR structure of the RING domain in ubiquitin ligase gp78
Class: ligase
Keywords: RING domain, ubiquitin, ligase
Deposited on 2012-08-27, released 2013-08-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-10-02, with a file datestamp of 2013-09-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: E3 ubiquitin-protein ligase AMFR
    Species: Homo sapiens [TaxId:9606]
    Gene: AMFR, RNF45
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2lxhc_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >2lxhC (C:)
knylrvvgnmearfavatpeelavnnddcaicwdsmqaarklpcghlfhnsclrswleqd
tscptcrmslniadnnrvree

    Sequence, based on observed residues (ATOM records): (download) 
    >2lxhC (C:)
avatpeelavnnddcaicwdsmqaarklpcghlfhnsclrswleqdtscptcrmslni