PDB entry 2lxa

View 2lxa on RCSB PDB site
Description: Solution structure of the Get5 ubiquitin-like domain
Class: protein binding
Keywords: ubiquitin-like domain, protein-protein interaction, Sgt2 binding domain, GET pathway, PROTEIN BINDING
Deposited on 2012-08-19, released 2012-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-like protein mdy2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: GET5, MDY2, TMA24, YOL111C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12285 (1-78)
      • initiating methionine (0)
      • expression tag (79-86)
    Domains in SCOPe 2.07: d2lxaa1, d2lxaa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2lxaA (A:)
mvhltlkkiqapkfsiehdfspsdtilqikqhliseekashiseiklllkgkvlhdnlfl
sdlkvtpanstitvmikpnlehhhhhh