PDB entry 2lx9

View 2lx9 on RCSB PDB site
Description: Solution Structure of Escherichia coli Ferrous Iron transport protein A (FeoA)
Class: transport protein
Keywords: FeoA, TRANSPORT PROTEIN
Deposited on 2012-08-16, released 2012-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-26, with a file datestamp of 2012-12-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrous iron transport protein A
    Species: Escherichia coli [TaxId:83333]
    Gene: b3408, feoA, JW3371
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEL3 (0-74)
      • engineered mutation (74)
      • expression tag (75-82)
    Domains in SCOPe 2.07: d2lx9a1, d2lx9a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lx9A (A:)
    mqytpdtawkitgfsreispayrqkllslgmlpgssfnvvrvaplgdpihietrrvslvl
    rkkdlalleveavsslehhhhhh