PDB entry 2lww

View 2lww on RCSB PDB site
Description: NMR structure of RelA-TAD/CBP-TAZ1 complex
Class: transcription
Keywords: NF-kappaB, p65, Transcription
Deposited on 2012-08-07, released 2013-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Mus musculus [TaxId:10090]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2lwwa_
  • Chain 'B':
    Compound: Nuclear transcription factor RelA
    Species: Mus musculus [TaxId:10090]
    Gene: Rela, mCG_11759
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q548Y4 (4-69)
      • expression tag (0-3)
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2lwwA (A:)
atgptadpekrkliqqqlvlllhahkcqrreqangevracslphcrtmknvlnhmthcqa
gkacqvahcassrqiishwknctrhdcpvclplknasdkr

  • Chain 'B':
    No sequence available.