PDB entry 2lwr

View 2lwr on RCSB PDB site
Description: Solution Structure of RING2 Domain from Parkin
Class: ligase
Keywords: Parkin, RING, E3 ligase, Zn-binding, METAL BINDING PROTEIN, STRUCTURAL PROTEIN, LIGASE
Deposited on 2012-08-06, released 2013-06-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-15, with a file datestamp of 2014-10-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SD01679p
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: park, CG10523
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q95TI4 (2-67)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d2lwra1, d2lwra2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lwrA (A:)
    gsaearwdeasnvtikvstkpcpkcrtpterdggcmhmvctragcgfewcwvcqtewtrd
    cmgahwfg