PDB entry 2lwp

View 2lwp on RCSB PDB site
Description: The NMR solution structure of the the ubiquitin homology domain of mouse BAG-1
Class: apoptosis
Keywords: proteasomal degradation, APOPTOSIS
Deposited on 2012-08-05, released 2013-06-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BAG family molecular chaperone regulator 1
    Species: Mus musculus [TaxId:10090]
    Gene: BAG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2lwpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2lwpA (A:)
makteemvqteemetprlsvivthsnerydllvtpqqgnsepvvqdlaqlveeatgvplp
fqklifkgkslkemetplsalgmqngcrvmligeksn