PDB entry 2lw8

View 2lw8 on RCSB PDB site
Description: NMR solution structure of Eph receptor
Class: signaling protein
Keywords: Eph receptor, ephrin, SIGNALING PROTEIN
Deposited on 2012-07-24, released 2013-07-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-A receptor 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Epha4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54764 (2-182)
      • expression tag (0-1)
      • conflict (177)
    Domains in SCOPe 2.08: d2lw8a1, d2lw8a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lw8A (A:)
    gsnevtlldsrsvqgelgwiaspleggweevsimdekntpirtyqvcnvmepsqnnwlrt
    dwitregaqrvyieikftlrdcnslpgvmgtcketfnlyyyesdndkerfirenqfvkid
    tiaadesftqvdigdrimklnteirdvgplskkgfylafqdvgacialvsvrvfykkapl
    tvr