PDB entry 2lvm

View 2lvm on RCSB PDB site
Description: Solution structure of human 53BP1 tandem Tudor domains in complex with a histone H4K20me2 peptide
Class: cell cycle
Keywords: dimethylation, CELL CYCLE
Deposited on 2012-07-07, released 2012-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-04-03, with a file datestamp of 2013-03-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor suppressor p53-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53BP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12888 (3-122)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d2lvma1, d2lvma2, d2lvma3
  • Chain 'B':
    Compound: histone h4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lvmA (A:)
    ghmnsfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipl
    dtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqy
    glg
    

  • Chain 'B':
    No sequence available.