PDB entry 2lvk

View 2lvk on RCSB PDB site
Description: Solution structure of Ca-bound Phl p 7
Class: allergen
Keywords: EF-hand protein, calcium-binding protein, ALLERGEN
Deposited on 2012-07-05, released 2012-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polcalcin Phl p 7
    Species: Phleum pratense [TaxId:15957]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2lvka_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lvkA (A:)
    addmerifkrfdtngdgkislseltdalrtlgstsadevqrmmaeidtdgdgfidfnefi
    sfcnanpglmkdvakvf