PDB entry 2lvi

View 2lvi on RCSB PDB site
Description: Solution structure of apo-Phl p 7
Class: allergen
Keywords: EF-hand protein, calcium-binding protein, ALLERGEN
Deposited on 2012-07-05, released 2012-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Polcalcin Phl p 7
  Species: Phleum pratense [TaxId:15957]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O82040 (0-76)
  Domains in SCOPe 2.08: d2lvia_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2lviA (A:)
  addmerifkrfdtngdgkislseltdalrtlgstsadevqrmmaeidtdgdgfidfnefi
  sfcnanpglmkdvakvf