PDB entry 2lve

View 2lve on RCSB PDB site
Description: recombinant len
Class: immunoglobulin
Keywords: immunoglobulin, kappa-IV, light chain dimer
Deposited on 1998-05-13, released 1999-05-18
The last revision prior to the SCOP 1.75 freeze date was dated 1999-05-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.214
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rlen
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2lvea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2lveA (A:)
    divmtqspdslavslgeratinckssqsvlyssnsknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleikr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lveA (A:)
    divmtqspdslavslgeratinckssqsvlyssnsknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleik