PDB entry 2lve

View 2lve on RCSB PDB site
Description:
Deposited on 1998-05-13, released 1999-05-18
The last revision prior to the SCOP 1.63 freeze date was dated 1999-05-18, with a file datestamp of 1999-05-17.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.214
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d2lve__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lve_ (-)
    divmtqspdslavslgeratinckssqsvlyssnsknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleik