PDB entry 2lvc

View 2lvc on RCSB PDB site
Description: Solution NMR Structure of Ig like domain (805-892) of Obscurin-like protein 1 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8578K
Class: structural protein
Keywords: Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-Biology, Protein Structure Initiative, STRUCTURAL PROTEIN
Deposited on 2012-06-30, released 2012-08-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Obscurin-like protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: KIAA0657, OBSL1
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75147 (3-90)
    • expression tag (1-2)
  Domains in SCOPe 2.05: d2lvca_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2lvcA (A:)
  shmpvhivdprehvfvhaitsecvmlacevdredapvrwykdgqeveesdfvvlenegph
  rrlvlpatqpsdggefqcvagdecayftvti
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2lvcA (A:)
  hmpvhivdprehvfvhaitsecvmlacevdredapvrwykdgqeveesdfvvlenegphr
  rlvlpatqpsdggefqcvagdecayftvti