PDB entry 2lvc

View 2lvc on RCSB PDB site
Description: Solution NMR Structure of Ig like domain (805-892) of Obscurin-like protein 1 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8578K
Class: structural protein
Keywords: Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-Biology, Protein Structure Initiative, STRUCTURAL PROTEIN
Deposited on 2012-06-30, released 2012-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Obscurin-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA0657, OBSL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75147 (3-90)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d2lvca1, d2lvca2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2lvcA (A:)
    shmpvhivdprehvfvhaitsecvmlacevdredapvrwykdgqeveesdfvvlenegph
    rrlvlpatqpsdggefqcvagdecayftvti
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lvcA (A:)
    hmpvhivdprehvfvhaitsecvmlacevdredapvrwykdgqeveesdfvvlenegphr
    rlvlpatqpsdggefqcvagdecayftvti