PDB entry 2lux

View 2lux on RCSB PDB site
Description: Calcium saturated form of human C85M S100A1 mutant
Class: metal binding protein
Keywords: metal binding protein
Deposited on 2012-06-22, released 2013-06-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A1
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A1, S100A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23297 (0-92)
      • engineered mutation (84)
    Domains in SCOPe 2.05: d2luxa_
  • Chain 'B':
    Compound: Protein S100-A1
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A1, S100A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23297 (0-92)
      • engineered mutation (84)
    Domains in SCOPe 2.05: d2luxb_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2luxA (A:)
    gseletametlinvfhahsgkegdkyklskkelkellqtelsgfldaqkdvdavdkvmke
    ldengdgevdfqeyvvlvaaltvamnnffwens
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2luxB (B:)
    gseletametlinvfhahsgkegdkyklskkelkellqtelsgfldaqkdvdavdkvmke
    ldengdgevdfqeyvvlvaaltvamnnffwens