PDB entry 2luq

View 2luq on RCSB PDB site
Description: Solution structure of double-stranded RNA binding domain of S.cerevisiae RNase III (rnt1p)
Class: RNA binding protein
Keywords: dsrbd, rnt1p, RNA binding protein
Deposited on 2012-06-19, released 2012-12-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ribonuclease 3
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Gene: RNT1, YM9408.01C, YM9959.21, YMR239C
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02555 (2-89)
    • expression tag (0-1)
  Domains in SCOPe 2.05: d2luqa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2luqA (A:)
  gsldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrnikia
  giraaenalrdkkmldfyakqraaiprses