PDB entry 2lup

View 2lup on RCSB PDB site
Description: RDC refined solution structure of double-stranded RNA binding domain of S. cerevisiae RNase III (rnt1p) in complex with the terminal RNA hairpin of snr47 precursor
Class: RNA binding protein/RNA
Keywords: DSRBD, RNT1P, SNR47, double strand RNA binding, RNA BINDING PROTEIN-RNA complex
Deposited on 2012-06-19, released 2012-07-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-07-04, with a file datestamp of 2012-06-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA (32-mer)
  • Chain 'B':
    Compound: Ribonuclease 3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: RNT1, YM9408.01C, YM9959.21, YMR239C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02555 (2-89)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d2lupb1, d2lupb2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lupB (B:)
    gsldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrnikia
    giraaenalrdkkmldfyakqraaiprses