PDB entry 2luo

View 2luo on RCSB PDB site
Description: NMR solution structure of apo-MptpA
Class: hydrolase
Keywords: Low Molecular Weight Tyrosine Phosphatase, MptpA, HYDROLASE
Deposited on 2012-06-19, released 2012-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: low molecular weight protein-tyrosine-phosphatase a
  Species: Mycobacterium tuberculosis [TaxId:1773]
  Gene: ptpA, Rv2234, MT2293, MTCY427.15
  Database cross-references and differences (RAF-indexed):
  • Uniprot P65716 (1-163)
    • expression tag (0)
  Domains in SCOPe 2.08: d2luoa1, d2luoa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2luoA (A:)
  gmsdplhvtfvctgnicrspmaekmfaqqlrhrglgdavrvtsagtgnwhvgscaderaa
  gvlrahgyptdhraaqvgtehlaadllvaldrnharllrqlgveaarvrmlrsfdprsgt
  haldvedpyygdhsdfeevfaviesalpglhdwvderlarngps