PDB entry 2luc

View 2luc on RCSB PDB site
Description: Solution Structure of human S100 calcium-binding protein A11
Class: metal binding protein
Keywords: EF-hand motif, homodimer, calcium-binding protein, METAL BINDING PROTEIN
Deposited on 2012-06-12, released 2013-05-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A11
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A11, MLN70, S100C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2luca_
  • Chain 'B':
    Compound: Protein S100-A11
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A11, MLN70, S100C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2lucb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lucA (A:)
    makisspteterciesliavfqkyagkdgynytlskteflsfmntelaaftknqkdpgvl
    drmmkkldtnsdgqldfseflnligglamachdsflkavpsqkrt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lucB (B:)
    makisspteterciesliavfqkyagkdgynytlskteflsfmntelaaftknqkdpgvl
    drmmkkldtnsdgqldfseflnligglamachdsflkavpsqkrt