PDB entry 2lu9

View 2lu9 on RCSB PDB site
Description: NMR solution structure of recombinant Tamapin
Class: toxin
Keywords: CS alpha beta, TOXIN
Deposited on 2012-06-08, released 2013-12-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-07-02, with a file datestamp of 2014-06-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium channel toxin alpha-KTx 5.4
    Species: Mesobuthus tamulus [TaxId:34647]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2lu9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lu9A (A:)
    afcnlrrcelscrslgllgkcigeeckcvpy