PDB entry 2ltp

View 2ltp on RCSB PDB site
Description: Solution structure of the SANT2 domain of the human nuclear receptor corepressor 2 (NCoR2), Northeast Structural Genomics Consortium (NESG) target ID HR4636E
Class: Transcription regulator
Keywords: SMRT, TRAC, SGC, Structural Genomics Consortium, NESG, Northeast Structural Genomics Consortium, Transcription regulator
Deposited on 2012-05-30, released 2012-06-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor corepressor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOR2, CTG26
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y618 (18-88)
      • conflict (24)
    Domains in SCOPe 2.04: d2ltpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ltpA (A:)
    mhhhhhhssgrenlyfqgwteeemgtakkgllehgrnwsaiarmvgsktvsqcknfyfny
    kkrqnldeilqqhklkmekernarrkkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ltpA (A:)
    wteeemgtakkgllehgrnwsaiarmvgsktvsqcknfyfnykkrqnldeilqqhklkme
    kernarrkkkk