PDB entry 2ltn

View 2ltn on RCSB PDB site
Description: design, expression, and crystallization of recombinant lectin from the garden pea (pisum sativum)
Class: lectin
Keywords: lectin
Deposited on 1990-06-26, released 1990-07-15
The last revision prior to the SCOP 1.73 freeze date was dated 1990-07-15, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.177
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pea lectin, alpha chain
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ltn.1
  • Chain 'B':
    Compound: pea lectin, beta chain
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ltn.1
  • Chain 'C':
    Compound: pea lectin, alpha chain
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ltn.2
  • Chain 'D':
    Compound: pea lectin, beta chain
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ltn.2
  • Heterogens: MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ltnA (A:)
    tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
    anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
    dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
    n
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ltnB (B:)
    vtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhselsgtsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ltnB (B:)
    vtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhselsg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ltnC (C:)
    tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
    anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
    dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
    n
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ltnD (D:)
    vtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhselsgtsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ltnD (D:)
    vtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhselsg