PDB entry 2lt9

View 2lt9 on RCSB PDB site
Description: The solution structure of Ca2+ binding domain 2B of the third isoform of the Na+/Ca2+ exchanger
Class: metal binding protein
Keywords: NCX, NCX3, NaCa exchanger, CBD, CBD2, calcium binding domain 2, METAL BINDING PROTEIN
Deposited on 2012-05-15, released 2012-08-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-09-12, with a file datestamp of 2012-09-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein Slc8a3
    Species: Mus musculus [TaxId:10090]
    Gene: Slc8a3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2lt9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2lt9A (A:)
    mashhhhhhhagiftfecdtihvsesigvmevkvlrtsgargtvivpfrtvegtakggge
    dfedaygelefkndetvktirvkivdeeeyerqenffialgepkwmergisevtdrkltv
    eeeeakriaemgkpvlgehpkleviieesyefkstvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lt9A (A:)
    hagiftfecdtihvsesigvmevkvlrtsgargtvivpfrtvegtakgggedfedaygel
    efkndetvktirvkivdeeeyerqenffialgepkwmergisevtdrkltveeeeakria
    emgkpvlgehpkleviieesyefkstvd