PDB entry 2lrx

View 2lrx on RCSB PDB site
Description: RNA structural dynamics are modulated through anti-folding by chaperones
Class: chaperone
Keywords: RNA chaperone, CHAPERONE
Deposited on 2012-04-15, released 2013-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding protein stpA
    Species: Escherichia coli [TaxId:83333]
    Gene: stpA, hnsB, b2669, JW2644
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2lrxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lrxA (A:)
    rqprpakykftdvngetktwtgqgrtpkpiaqalaegkslddfli