PDB entry 2lrw

View 2lrw on RCSB PDB site
Description: Solution structure of a ubiquitin-like protein from Trypanosoma brucei
Class: cell cycle
Keywords: posttranslational protein modifier, cell cycle
Deposited on 2012-04-13, released 2013-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-04-24, with a file datestamp of 2013-04-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin, putative
    Species: Trypanosoma brucei brucei [TaxId:999953]
    Gene: Tb927.4.2540
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2lrwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2lrwA (A:)
    hhhhhhmllkvktvsnkviqitsltddntiaelkgkleesegipgnmirlvyqgkqlede
    krlkdyqmsagatfhmvvalragc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lrwA (A:)
    mllkvktvsnkviqitsltddntiaelkgkleesegipgnmirlvyqgkqledekrlkdy
    qmsagatfhmvvalragc