PDB entry 2lrr

View 2lrr on RCSB PDB site
Description: Solution structure of the R3H domain from human Smubp-2 in complex with 2'-deoxyguanosine-5'-monophosphate
Class: hydrolase
Keywords: DNA Binding Protein, HYDROLASE
Deposited on 2012-04-12, released 2012-10-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding protein SMUBP-2
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHMBP2, SMBP2, smubp-2, SMUBP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2lrra_
  • Heterogens: DGP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2lrrA (A:)
    mgslnggspegvesqdgvdhframivefmaskkmqlefppslnshdrlrvhqiaeehglr
    hdssgegkrrfitvskragshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lrrA (A:)
    pegvesqdgvdhframivefmaskkmqlefppslnshdrlrvhqiaeehglrhdssgegk
    rrfitvskra