PDB entry 2lrq

View 2lrq on RCSB PDB site
Description: Chemical Shift Assignment and Solution Structure of Fr822A from Drosophila melanogaster. Northeast Structural Genomics Consortium Target Fr822A
Class: transcription
Keywords: Epigenetics, Lid Complex, TRANSCRIPTION
Deposited on 2012-04-11, released 2012-07-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-07-04, with a file datestamp of 2012-06-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NuA4 complex subunit EAF3 homolog
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: MRG15, CG6363
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y0I1 (1-84)
      • initiating methionine (0)
    Domains in SCOPe 2.05: d2lrqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lrqA (A:)
    mnystgtdantlfvdgervlcfhgpliyeakvlktkpdatpveyyihyagwsknwdewvp
    enrvlkynddnvkrrqelarqcger