PDB entry 2lrl

View 2lrl on RCSB PDB site
Description: Solution Structures of the IIA(Chitobiose)-HPr complex of the N,N'-Diacetylchitobiose Branch of the Escherichia coli Phosphotransferase System
Class: transferase
Keywords: protein-protein complex, TRANSFERASE
Deposited on 2012-04-06, released 2012-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n,n'-diacetylchitobiose-specific phosphotransferase enzyme iia component
    Species: Escherichia coli [TaxId:83333]
    Gene: chbA, celC, b1736, JW1725
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69791 (0-102)
      • engineered mutation (78)
    Domains in SCOPe 2.08: d2lrla_
  • Chain 'B':
    Compound: n,n'-diacetylchitobiose-specific phosphotransferase enzyme iia component
    Species: Escherichia coli [TaxId:83333]
    Gene: chbA, celC, b1736, JW1725
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69791 (0-102)
      • engineered mutation (78)
    Domains in SCOPe 2.08: d2lrlb_
  • Chain 'C':
    Compound: n,n'-diacetylchitobiose-specific phosphotransferase enzyme iia component
    Species: Escherichia coli [TaxId:83333]
    Gene: chbA, celC, b1736, JW1725
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69791 (0-102)
      • engineered mutation (78)
    Domains in SCOPe 2.08: d2lrlc_
  • Chain 'D':
    Compound: Phosphocarrier protein HPr
    Species: Escherichia coli [TaxId:83333]
    Gene: ptsH, hpr, b2415, JW2408
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2lrld_
  • Heterogens: PO3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2lrlA (A:)
aeeleevvmgliinsgqarslayaalkqakqgdfaaakammdqsrmalneahlvqtklie
gdagegkmkvslvlvhaqlhlmtsmlarelitelielheklka

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2lrlB (B:)
aeeleevvmgliinsgqarslayaalkqakqgdfaaakammdqsrmalneahlvqtklie
gdagegkmkvslvlvhaqlhlmtsmlarelitelielheklka

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2lrlC (C:)
aeeleevvmgliinsgqarslayaalkqakqgdfaaakammdqsrmalneahlvqtklie
gdagegkmkvslvlvhaqlhlmtsmlarelitelielheklka

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2lrlD (D:)
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele