PDB entry 2lrb

View 2lrb on RCSB PDB site
Description: Solution Structure of ADF like UNC-60A Protein of Caenorhabditis elegans
Class: protein binding
Keywords: ADF/cofilin protein, PROTEIN BINDING
Deposited on 2012-03-28, released 2013-05-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-06-11, with a file datestamp of 2014-06-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actin-depolymerizing factor 1, isoforms a
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: unc-60, C38C3.5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2lrba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2lrbA (A:)
mssgvmvdpdvqtsfqklsegrkeyryiifkidenkviveaavtqdqlgitgddyddssk
aafdkfvedvksrtdnltdcryavfdfkftcsrvgagtskmdkiiflqicpdgasikkkm
vyassaaaiktslgtgkilqfqvsdesemshkellnklgekygdh