PDB entry 2lqo

View 2lqo on RCSB PDB site
Description: Mrx1 reduced
Class: oxidoreductase
Keywords: Trx fold, OXIDOREDUCTASE
Deposited on 2012-03-10, released 2012-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative glutaredoxin Rv3198.1/MT3292
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv3198.1, MT3292, Rv3198A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VJ51 (0-83)
      • conflict (1)
      • expression tag (84-87)
    Domains in SCOPe 2.07: d2lqoa1, d2lqoa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2lqoA (A:)
    mvtaaltiyttswcgyclrlktaltanriaydevdiehnraaaefvgsvnggnrtvptvk
    fadgstltnpsadevkaklvkiaglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lqoA (A:)
    mvtaaltiyttswcgyclrlktaltanriaydevdiehnraaaefvgsvnggnrtvptvk
    fadgstltnpsadevkaklvkiaglehh