PDB entry 2lqd

View 2lqd on RCSB PDB site
Description: Reduced and CO-bound cytochrome P450cam (CYP101A1)
Class: hydrolase
Keywords: metalloenzyme, monooxygenase, HYDROLASE
Deposited on 2012-03-02, released 2012-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Camphor 5-monooxygenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2lqda_
  • Heterogens: HEM, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2lqdA (A:)
    tetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngg
    hwiatrgqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgm
    pvvdklenriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkylt
    dqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrm
    cglllvggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgril
    tsdyefhgvqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqh
    larreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lqdA (A:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
    ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav