PDB entry 2lqb

View 2lqb on RCSB PDB site
Description: Metal binding repeat 2 of the Wilson disease protein (ATP7B)
Class: hydrolase
Keywords: copper binding, HYDROLASE
Deposited on 2012-02-28, released 2013-07-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-transporting ATPase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ATP7B, PWD, WC1, WND
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35670 (4-75)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d2lqba1, d2lqba2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lqbA (A:)
    aghmqeavvklrvegmtcqscvssiegkvrklqgvvrvkvslsnqeavityqpyliqped
    lrdhvndmgfeaaiks