PDB entry 2lpd

View 2lpd on RCSB PDB site
Description: Solution structure of a MbtH-like protein from Burkholderia pseudomallei, the etiological agent responsible for melioidosis, Seattle Structural Genomics Center for Infectious Disease target BupsA.13472.b
Class: Structural Genomics, Unknown Function
Keywords: infectious disease, melioidosis, Seattle Structural Genomics Center for Infectious Disease, SSGCID, drug target, Structural Genomics, Unknown Function
Deposited on 2012-02-10, released 2012-02-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Uncharacterized protein
  Species: Burkholderia pseudomallei [TaxId:28450]
  Gene: BPSL1726, BURPS1710b_2147
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q63U90 (21-94)
    • expression tag (0-20)
  Domains in SCOPe 2.06: d2lpda1, d2lpda2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2lpdA (A:)
  mahhhhhhmgtleaqtqgpgsmddelyfvvrnnegqysvwmdgrslpagwetvgepatkq
  qclqrieqlwtdmvpasvrehlnqhsgpgidyavr