PDB entry 2lp2

View 2lp2 on RCSB PDB site
Description: Solution structure and dynamics of human S100A1 protein modified at cysteine 85 with homocysteine disulfide bond formation in calcium saturated form
Class: metal binding protein
Keywords: Calcium bound form, EF-hand, calcium binding, helix reorientation, signaling protein, thionylation, small thiols, METAL BINDING PROTEIN
Deposited on 2012-01-31, released 2013-02-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-08-27, with a file datestamp of 2014-08-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A1
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A1, S100A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2lp2a_
  • Chain 'B':
    Compound: Protein S100-A1
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A1, S100A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2lp2b_
  • Heterogens: HCS, CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lp2A (A:)
    gseletametlinvfhahsgkegdkyklskkelkellqtelsgfldaqkdvdavdkvmke
    ldengdgevdfqeyvvlvaaltvacnnffwens
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lp2B (B:)
    gseletametlinvfhahsgkegdkyklskkelkellqtelsgfldaqkdvdavdkvmke
    ldengdgevdfqeyvvlvaaltvacnnffwens