PDB entry 2loz

View 2loz on RCSB PDB site
Description: The novel binding mode of DLC1 and Tensin2 PTB domain
Class: hydrolase/hydrolase activator
Keywords: PTB, DLC1, HYDROLASE-HYDROLASE ACTIVATOR complex
Deposited on 2012-01-29, released 2012-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tensin-like C1 domain-containing phosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: TENC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2loza_
  • Chain 'B':
    Compound: Rho GTPase-activating protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: DLC1
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lozA (A:)
    mstaadllrqgaacsvlyltsvetesltgpqavarassaalscsprptpavvhfkvsaqg
    itltdnqrklffrrhypvnsitfsstdpqdrrwtnpdgttskifgfvakkpgspwenvch
    lfaeldpdqpagaivtfitkvllgqrk
    

  • Chain 'B':
    No sequence available.