PDB entry 2lox

View 2lox on RCSB PDB site
Description: NMR structure of the complex between the PH domain of the Tfb1 subunit from TFIIH and Rad2
Class: transcription/hydrolase
Keywords: TRANSCRIPTION-HYDROLASE complex
Deposited on 2012-01-27, released 2012-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-11, with a file datestamp of 2012-07-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase II transcription factor B subunit 1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: D9740.3, TFB1, YDR311W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32776 (1-114)
      • expression tag (0)
    Domains in SCOPe 2.07: d2loxa1, d2loxa2
  • Chain 'B':
    Compound: DNA repair protein RAD2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: RAD2, YGR258C
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2loxA (A:)
    pshsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmml
    rligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdadgnss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2loxA (A:)
    pshsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmml
    rligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdad
    

  • Chain 'B':
    No sequence available.