PDB entry 2lon

View 2lon on RCSB PDB site
Description: Backbone structure of human membrane protein HIGD1B
Deposited on 2012-01-26, released 2012-05-23
The last revision was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HIG1 domain family member 1B
    Species: Homo sapiens [TaxId:9606]
    Gene: HIGD1B
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2lonA (A:)
msanrrwwvppddedcvsekllrktresplvpiglggclvvaayriyrlrsrgstkmsih
lihtrvaaqacavgaimlgavytmysdyvkrmaqdagek