PDB entry 2lol

View 2lol on RCSB PDB site
Description: NMR structure of an acyl-carrier protein from Rickettsia prowazekii, Seattle Structural Genomics Center for Infectious Disease (SSGCID)
Class: lipid transport
Keywords: lipid transport
Deposited on 2012-01-25, released 2012-02-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl carrier protein
    Species: Rickettsia prowazekii str. Madrid E [TaxId:272947]
    Gene: RP763
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2lola_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2lolA (A:)
msttdkieqkviemvaeklnkdkaiittdsrfiedlkadsldtvelmmaieveygidipd
deatkiktvsdvikyikerqs